Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d049054_circ_g.1 |
ID in PlantcircBase | zma_circ_007973 |
Alias | zma_circ_0001546, GRMZM2G545326_C1 |
Organism | Zea mays |
Position | chr4: 14039378-14040084 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d049054 |
Parent gene annotation |
Cysteine proteinases superfamily protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d049054_T001:3 Zm00001d049054_T003:3 Zm00001d049054_T002:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.127025829 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14039606-14039405(+) 14039505-14039776(-) |
Potential amino acid sequence |
MEDLWKHIDEDKKSAYAYLDSLWFNMYYHGSNKPNVLKWIKAKRIFSRQYVFVPIVCFGHWSLL VLCHFGDANCSDIKKGPRMMVLDSLNTTDPTRLRSAIRKVPKQGFSNK*(+) MKAIHFWISSQMSSMLLLIHFSISQMSSMLLFYLFENPCFGTFLIADRNLVGSVVLSESSTIIR GPFLISEQFASPKWHKTRRLQCPKQTIGTKTYCLENILLAFIHLRTLGLLLPW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |