Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G79830_circ_g.5 |
| ID in PlantcircBase | ath_circ_011113 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 30030423-30030482 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT1G79830 |
| Parent gene annotation |
Golgin Putative 5 |
| Parent gene strand | - |
| Alternative splicing | AT1G79830_circ_g.3 AT1G79830_circ_g.4 AT1G79830_circ_g.6 AT1G79830_circ_g.7 |
| Support reads | 3 |
| Tissues | root, aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G79830.1:1 AT1G79830.4:1 AT1G79830.3:1 AT1G79830.5:1 AT1G79830.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.083333333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30030465-30030425(-) |
| Potential amino acid sequence |
MFRGEIEDLQRRYQAVYREDMFRGEIEDLQRRYQAVYREDMFRGEIEDLQRRYQAVYREDMFRG EIEDLQRRYQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |