Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G11880_circ_g.2 |
| ID in PlantcircBase | ath_circ_037705 |
| Alias | At_ciR5958 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 3828917-3829066 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT5G11880 |
| Parent gene annotation |
Diaminopimelate decarboxylase 2, chloroplastic |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G11880.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.373893384 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3828938-3829063(+) |
| Potential amino acid sequence |
MTMSSNKLQLFGMCLHFIQKPLKLLVPNTKLRVLVPSSYIWMHLCNGRTKMTMSSNKLQLFGMC LHFIQKPLKLLVPNTKLRVLVPSSYIWMHLCNGRTKMTMSSNKLQLFGMCLHFIQKPLKLLVPN TKLRVLVPSSYIWMHLCNGRTKMTMSSNKLQLFGMCLHFIQKPLKLLVPNTKLRVLVPSSYIWM H(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |