Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G26780_circ_g.6 |
ID in PlantcircBase | ath_circ_015037 |
Alias | AT2G26780_C1, AT2G26780_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 11413187-11414082 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT2G26780 |
Parent gene annotation |
ARM repeat superfamily protein |
Parent gene strand | + |
Alternative splicing | AT2G26780_circ_g.1 AT2G26780_circ_g.2 AT2G26780_circ_g.3 AT2G26780_circ_g.4 AT2G26780_circ_g.5 AT2G26780_circ_g.7 AT2G26780_circ_g.8 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G26780.2:5 AT2G26780.1:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.371275042 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11413212-11413193(+) |
Potential amino acid sequence |
MGPVILNAILKMLDGFTGSETDALSRETKTFSFQAIGLLAQRLPQLFREKTEMAVRLFDALKLE TQSLRSTIQEAIVSLAAAYKDSPENILRDLEVLLLANSLAEQNEARFCALRWATSLYNSHHCPS LYICMLSAADPKLDIRGR* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |