Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G34020_circ_g.2 |
| ID in PlantcircBase | ath_circ_034530 |
| Alias | At_ciR3789, Ath_circ_FC2977 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16299209-16299409 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT4G34020 |
| Parent gene annotation |
Protein DJ-1 homolog C |
| Parent gene strand | - |
| Alternative splicing | AT4G34020_circ_g.3 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G34020.1:1 AT4G34020.2:1 AT4G34020.3:1 AT4G34020.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.347389558 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16299216-16299406(+) |
| Potential amino acid sequence |
MIRSYDDSAASPINLSVIILVPWNAVIRKDRSTDETVTSTLALLRTSAIETSSTASDPLATGIR TGRMIRSYDDSAASPINLSVIILVPWNAVIRKDRSTDETVTSTLALLRTSAIETSSTASDPLAT GIRTGRMIRSYDDSAASPINLSVIILVPWNAVIRKDRSTDETVTSTLALLRTSAIETSSTASDP LATGIRTGRMIRSYDDSAASPINLSVIILVPWNAVIRKDRSTDETVTSTLALLRTSAIETSSTA SDPLATGIR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chen et al., 2017a |