Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc06g083870.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_002130 |
| Alias | 6:45464469|45465850 |
| Organism | Solanum lycopersicum |
| Position | chr6: 49174469-49175850 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc06g083870.2 |
| Parent gene annotation |
Structural maintenance of chromosomes protein 1 |
| Parent gene strand | + |
| Alternative splicing | Solyc06g083870.2_circ_g.1 |
| Support reads | 6 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc06g083870.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.728136172 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
49174593-49174472(+) 49174532-49174522(+) |
| Potential amino acid sequence |
MLRLKRKVLQTNFKIWNAKRGVLKMKLDISSLNLSSA*(+) MQLKESEASGRISGLEKKIHYAEIEKKSIADKLQNLEREKGSIENEIRHIQPELEQCLRRKKKV SSQSWRSLDQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |