Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G15165_circ_g.1 |
ID in PlantcircBase | ath_circ_002638 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 5218521-5218911 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT1G15165 |
Parent gene annotation |
RING/FYVE/PHD zinc finger superfamily protein |
Parent gene strand | - |
Alternative splicing | 1_circ_ag.3 1_circ_ag.4 AT1G15165_circ_g.2 1_circ_ag.3 1_circ_ag.4 1_circ_ag.5 1_circ_ag.6 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G15165.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.36719414 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5218575-5218523(-) |
Potential amino acid sequence |
MKSLRRMEDIVPRSSGFQLHRDVCARNYLHFITRCGRSSCRWKLQDLGVNPGFKPCVRYIIHLR KQRTFFNTVLSHHWGCYTVEIEKPKYACMKSLRRMEDIVPRSSGFQLHRDVCARNYLHFITRCG RSSCRWKLQDLGVNPGFKPCVRYIIHLRKQRTFFNTVLSHHWGCYTVEIEKPKYACMKSLRRME DIVPRSSGFQLHRDVCARNYLHFITRCGRSSCRWKLQDLGVNPGFKPCVRYIIHLRKQRTFFNT VLSHHWGCYTVEIEKPKYACMKSLRRMEDIVPRSSGFQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |