Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0167900_circ_g.5 |
ID in PlantcircBase | osa_circ_010605 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 3430384-3430688 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os12g0167900 |
Parent gene annotation |
Ribosomal protein L3A (Os12t0167900-01) |
Parent gene strand | + |
Alternative splicing | Os12g0167900_circ_g.6 |
Support reads | 136 |
Tissues | shoot, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0167900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003306* |
PMCS | 0.71510306 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3430630-3430644(+) 3430446-3430674(-) |
Potential amino acid sequence |
MQLEKMKKYASIVRVIAHTQSSTRRKPARLLPSSRPLRLSLLDSWPMSRHLVDFALSTLSGPST LARRCGEGSTRTGAKARRRLSLSMPLSMTVMLARKKSRCNLRR*(+) MTSGGVSMMVTASQVSFLWSSECGQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |