Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0167900_circ_g.5 |
| ID in PlantcircBase | osa_circ_010605 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 3430384-3430688 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os12g0167900 |
| Parent gene annotation |
Ribosomal protein L3A (Os12t0167900-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0167900_circ_g.6 |
| Support reads | 136 |
| Tissues | shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0167900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003306* |
| PMCS | 0.71510306 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3430630-3430644(+) 3430446-3430674(-) |
| Potential amino acid sequence |
MQLEKMKKYASIVRVIAHTQSSTRRKPARLLPSSRPLRLSLLDSWPMSRHLVDFALSTLSGPST LARRCGEGSTRTGAKARRRLSLSMPLSMTVMLARKKSRCNLRR*(+) MTSGGVSMMVTASQVSFLWSSECGQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |