Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G74960_circ_g.12 |
| ID in PlantcircBase | ath_circ_010228 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 28153393-28153998 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G74960 |
| Parent gene annotation |
3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic |
| Parent gene strand | - |
| Alternative splicing | AT1G74960_circ_g.1 AT1G74960_circ_g.2 AT1G74960_circ_g.3 AT1G74960_circ_g.4 AT1G74960_circ_g.5 AT1G74960_circ_g.6 AT1G74960_circ_g.7 AT1G74960_circ_g.8 AT1G74960_circ_g.9 AT1G74960_circ_g.10 AT1G74960_circ_g.11 AT1G74960_circ_g.13 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G74960.1:3 AT1G74960.3:3 AT1G74960.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.24250147 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28153666-28153395(-) |
| Potential amino acid sequence |
MGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTEPHPDGLGGFVACRALSQRNNDPT KASRPWDTNRDGFVMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTEPHPDGLGGF VACRALSQRNNDPTKASRPWDTNRDGFVMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDA YHMTEPHPDGLGGFVACRALSQRNNDPTKASRPWDTNRDGFVMGEGAGVLLLEELEHAKKRGAT IYAEFLGGSFTCDAYHMTEPHPD(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |