Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0178100_circ_g.1 |
ID in PlantcircBase | osa_circ_018186 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 4121201-4122334 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0178100 |
Parent gene annotation |
Similar to Copper-translocating P-type ATPase family protein, ex pressed. (Os03t0178100-00) |
Parent gene strand | - |
Alternative splicing | Os03g0178100_circ_g.2 Os03g0178100_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0178100-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.309941013 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4122269-4121238(+) 4122031-4122286(-) |
Potential amino acid sequence |
MASIPAKRSKTSPPLISSPRLAPLQPDVPLLAMQL*(+) MEEAELLKLDIPATSGQLTEPGFGCLAEVDGCLVAVGTLDWVHNRFETKASSTELTDLGNHLEF VSSSEASSNHSKSIAYVGREGEGIIGAIAVSDVLRDDAKATVDRLQQEEILTFLLSGDRKEAVE SIGRTVGIRSENIKSSLTPHEKAGIITALQGEGRRVAMVLNGDYLLEGVMFWSV*(-) |
Sponge-miRNAs | osa-miR2866 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |