Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0780550_circ_g.1 |
| ID in PlantcircBase | osa_circ_016787 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 33070647-33070717 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0780550 |
| Parent gene annotation |
Similar to smr domain containing protein. (Os02t0780550-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0780550-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1103277 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33070653-33070680(+) 33070697-33070666(-) 33070708-33070666(-) |
| Potential amino acid sequence |
MCSESRGEAGDFARIRNTCFEQQACAQNQGGKLVILPAYAIHVLNNKHVLRIKGGSW*(+) MRAKSPASPLDSEHMLVVQNMYCVCGQNHQLPPLILSTCLLFKTCIAYAGKITSFPP*(-) MYCVCGQNHQLPPLILSTCLLFKTCIAYAGKITSFPP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |