Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G254030_circ_g.4 |
| ID in PlantcircBase | csa_circ_001732 |
| Alias | Chr3:15843490_15843979 |
| Organism | Cucumis sativus |
| Position | chrChr3: 15843490-15843979 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | ue-circRNA |
| Identification method | CIRI2;Find_circ |
| Parent gene | Csa3G254030 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | Csa7G336540_circ_g.1 Csa7G336540_circ_g.2 Csa7G336540_circ_g.3 |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa3G254030.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.859183265 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15843719-15843931(-) 15843568-15843891(-) |
| Potential amino acid sequence |
MELRMKVSQAVHVLNHDTQSCNRVAANQWLVQFQQTGAAWEVATAILTSDHVQPSMSSFVPDLE VEFFAAQILKRKGCKSCNPLWTGPVAWA* MFSLQCPPLSLIWKSSSLQLRFLNARVVKVVILCGLGQSLGRNLLEYIMQPWTQV* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhu et al., 2019;He et al., 2020 |