Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d043325_circ_g.3 |
| ID in PlantcircBase | zma_circ_007784 |
| Alias | Zm03circ00084, GRMZM5G897926_C1 |
| Organism | Zea mays |
| Position | chr3: 196563266-196564189 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d043325 |
| Parent gene annotation |
plastid transcriptionally active chromosome 12 homolog |
| Parent gene strand | - |
| Alternative splicing | Zm00001d043325_circ_g.1 Zm00001d043325_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d043325_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.144704535 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
196564102-196563275(+) 196564037-196564126(-) |
| Potential amino acid sequence |
MYPCFYKLQPILSSTLLALFLLVSFALLLTSIR*(+) MFQHQTAGEYRIMMGTDVRIQRDPLAMRMREDQIKQIWGGDPVYPTINYVQDPDEVIDYRGPEF HEPTPEVVPYLMEVRSRAKETRRNRANSVLLRMG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |