Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G238500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000536 |
| Alias | Chr05:61991920|61992640 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 61991920-61992640 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G238500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.005G238500.5:2 Gorai.005G238500.6:2 Gorai.005G238500.3:2 Gorai.005G238500.1:2 Gorai.005G238500.2:2 Gorai.005G238500.8:2 Gorai.005G238500.7:2 Gorai.005G238500.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.453882836 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
61991927-61992506(-) 61992619-61992589(-) 61992632-61991973(+) |
| Potential amino acid sequence |
MEGYALPSFLCGYSFIKANLIFSSAFLVKKAHHLIRLLAILQILICW*(-) MRLQLHQSQLDFLISFFGEKSTSLDQTTSYPPDTDLLVKKSHNLAGHAIANEALLPYFQKFDIW PIIVRVDYSPHHVDLAALKGGKYAELVNFVPWKVTHCPPSYAVTASSKPT*(-) MRNLPWNKVYKFRIFTTFQCS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |