Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d023741_circ_g.2 | 
| ID in PlantcircBase | zma_circ_010171 | 
| Alias | zma_circ_0000118, GRMZM2G082271_C1 | 
| Organism | Zea mays | 
| Position | chr10: 18392139-18392467 JBrowse» | 
| Reference genome | AGPv4.38 | 
| Type | u-circRNA | 
| Identification method | find_circ, CIRI2 | 
| Parent gene | Zm00001d023741 | 
| Parent gene annotation | Alanine--tRNA ligase | 
| Parent gene strand | - | 
| Alternative splicing | Zm00001d023741_circ_g.1 | 
| Support reads | NA | 
| Tissues | leaf, root | 
| Exon boundary | Yes-Yes | 
| Splicing signals | CT-AC | 
| Number of exons covered | Zm00001d023741_T003:2 Zm00001d023741_T019:2 Zm00001d023741_T016:2 Zm00001d023741_T018:2 Zm00001d023741_T004:2 Zm00001d023741_T002:2 Zm00001d023741_T009:2 Zm00001d023741_T006:2 Zm00001d023741_T005:2 Zm00001d023741_T011:2 Zm00001d023741_T008:2 Zm00001d023741_T007:2 Zm00001d023741_T001:2 Zm00001d023741_T015:2 | 
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA | 
| PMCS | 0.330218179 | 
| Functional Information | |
|---|---|
| Coding potential | Y | 
| Potential coding position | 18392354-18392242(+) | 
| Potential amino acid sequence | MRFASSSFISSAYTPSSSFICWFTMNSIFLRSSGWTGFPPHSSVDMDSHSLLSGSASRSSTLRP TDTTLTGSG*(+) | 
| Sponge-miRNAs | NA | 
| circRNA-miRNA-mRNA network | VISUALIZATION | 
| Potential function description | responsive to drought stress | 
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |