Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d023741_circ_g.2 |
ID in PlantcircBase | zma_circ_010171 |
Alias | zma_circ_0000118, GRMZM2G082271_C1 |
Organism | Zea mays |
Position | chr10: 18392139-18392467 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d023741 |
Parent gene annotation |
Alanine--tRNA ligase |
Parent gene strand | - |
Alternative splicing | Zm00001d023741_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d023741_T003:2 Zm00001d023741_T019:2 Zm00001d023741_T016:2 Zm00001d023741_T018:2 Zm00001d023741_T004:2 Zm00001d023741_T002:2 Zm00001d023741_T009:2 Zm00001d023741_T006:2 Zm00001d023741_T005:2 Zm00001d023741_T011:2 Zm00001d023741_T008:2 Zm00001d023741_T007:2 Zm00001d023741_T001:2 Zm00001d023741_T015:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.330218179 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18392354-18392242(+) |
Potential amino acid sequence |
MRFASSSFISSAYTPSSSFICWFTMNSIFLRSSGWTGFPPHSSVDMDSHSLLSGSASRSSTLRP TDTTLTGSG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |