Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d023741_circ_g.2 |
| ID in PlantcircBase | zma_circ_010171 |
| Alias | zma_circ_0000118, GRMZM2G082271_C1 |
| Organism | Zea mays |
| Position | chr10: 18392139-18392467 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d023741 |
| Parent gene annotation |
Alanine--tRNA ligase |
| Parent gene strand | - |
| Alternative splicing | Zm00001d023741_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d023741_T003:2 Zm00001d023741_T019:2 Zm00001d023741_T016:2 Zm00001d023741_T018:2 Zm00001d023741_T004:2 Zm00001d023741_T002:2 Zm00001d023741_T009:2 Zm00001d023741_T006:2 Zm00001d023741_T005:2 Zm00001d023741_T011:2 Zm00001d023741_T008:2 Zm00001d023741_T007:2 Zm00001d023741_T001:2 Zm00001d023741_T015:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.330218179 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18392354-18392242(+) |
| Potential amino acid sequence |
MRFASSSFISSAYTPSSSFICWFTMNSIFLRSSGWTGFPPHSSVDMDSHSLLSGSASRSSTLRP TDTTLTGSG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |