Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0459300_circ_g.1 |
ID in PlantcircBase | osa_circ_011448 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 16100121-16100682 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0459300 |
Parent gene annotation |
Nucleic acid-binding, OB-fold domain containing protein. (Os12t0 459300-01);Hypothetical gene. (Os12t0459300-02);Nucleic acid-bin ding, OB-fold domain containing protein. (Os12t0459300-03) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0459300-03:3 Os12t0459300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.111803084 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16100218-16100139(+) 16100138-16100626(-) |
Potential amino acid sequence |
MQATQHCLSHCGEIDQLQKIYKDGQTKPQVVVFVGTLVRDYAGIGLTITGSSPCKWYINLDIPD VLELKERYYGRHY*(+) MTPIISFFQFEHVRYVQIDIPFAW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |