Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0479200_circ_g.1 |
| ID in PlantcircBase | osa_circ_033789 |
| Alias | Os07circ08039/Os_ciR529 |
| Organism | Oryza sativa |
| Position | chr7: 17407832-17408700 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, SMALT, Segemehl, circseq_cup, find_circ |
| Parent gene | Os07g0479200 |
| Parent gene annotation |
Similar to SL15-like (Fragment). (Os07t0479200-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/62/37/44 |
| Tissues | leaf/root/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0479200-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017062 |
| PMCS | 0.221083439 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17408044-17408043(+) 17407999-17407993(-) |
| Potential amino acid sequence |
MNKGTGELSFLTCFMNFAGSIVRVFTSIQEKTPLSDIADWLQQYWVGKLTLLFLKSSMLLSMLS SSLLGFHRYGRIL*(+) MLRSIEDFKKSRVNFPTQYCWSQSAISLKGVFSWMLVNTLTMEPAKFMKQVRKLSSPVPLFIKF FHICGSLAKKKIAC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |