Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0479200_circ_g.1 |
ID in PlantcircBase | osa_circ_033789 |
Alias | Os07circ08039/Os_ciR529 |
Organism | Oryza sativa |
Position | chr7: 17407832-17408700 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, SMALT, Segemehl, circseq_cup, find_circ |
Parent gene | Os07g0479200 |
Parent gene annotation |
Similar to SL15-like (Fragment). (Os07t0479200-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3/62/37/44 |
Tissues | leaf/root/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0479200-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017062 |
PMCS | 0.221083439 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17408044-17408043(+) 17407999-17407993(-) |
Potential amino acid sequence |
MNKGTGELSFLTCFMNFAGSIVRVFTSIQEKTPLSDIADWLQQYWVGKLTLLFLKSSMLLSMLS SSLLGFHRYGRIL*(+) MLRSIEDFKKSRVNFPTQYCWSQSAISLKGVFSWMLVNTLTMEPAKFMKQVRKLSSPVPLFIKF FHICGSLAKKKIAC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |