Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d002129_circ_g.2 |
ID in PlantcircBase | zma_circ_007031 |
Alias | Zm02circ00006 |
Organism | Zea mays |
Position | chr2: 6418124-6419996 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d002129 |
Parent gene annotation |
Protein kinase superfamily protein |
Parent gene strand | - |
Alternative splicing | Zm00001d002129_circ_g.3 Zm00001d002129_circ_g.4 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d002129_T001:6 Zm00001d002129_T003:1 Zm00001d002129_T002:6 Zm00001d002129_T004:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.053996054 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6418928-6419985(-) |
Potential amino acid sequence |
MQEMDYREEARNGLKFRELFGKFRDVSVPEMYLEQTRRRVLIMEWIEGEKLSEVRDQYLVEVGV YCSLSQLLEYGFYHADPHPGNLLRTVDGKLAYLGLPG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |