Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d002129_circ_g.2 |
| ID in PlantcircBase | zma_circ_007031 |
| Alias | Zm02circ00006 |
| Organism | Zea mays |
| Position | chr2: 6418124-6419996 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d002129 |
| Parent gene annotation |
Protein kinase superfamily protein |
| Parent gene strand | - |
| Alternative splicing | Zm00001d002129_circ_g.3 Zm00001d002129_circ_g.4 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d002129_T001:6 Zm00001d002129_T003:1 Zm00001d002129_T002:6 Zm00001d002129_T004:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.053996054 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6418928-6419985(-) |
| Potential amino acid sequence |
MQEMDYREEARNGLKFRELFGKFRDVSVPEMYLEQTRRRVLIMEWIEGEKLSEVRDQYLVEVGV YCSLSQLLEYGFYHADPHPGNLLRTVDGKLAYLGLPG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |