Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G56220_circ_g.2 |
| ID in PlantcircBase | ath_circ_007718 |
| Alias | At_ciR5426, AT1G56220_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 21043704-21043889 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full, CIRI2 |
| Parent gene | AT1G56220 |
| Parent gene annotation |
Dormancy/auxin associated family protein |
| Parent gene strand | + |
| Alternative splicing | AT1G56220_circ_g.1 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G56220.4:1 AT1G56220.5:1 AT1G56220.1:1 AT1G56220.2:1 AT1G56220.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.538056374 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21043784-21043886(+) |
| Potential amino acid sequence |
MIIKPPGYQGSSAPASPAGSTPPLSPFSPPLSPFSDQSEAGSARSYGEDSLPEEAVKVTRSIMI IKPPGYQGSSAPASPAGSTPPLSPFSPPLSPFSDQSEAGSARSYGEDSLPEEAVKVTRSIMIIK PPGYQGSSAPASPAGSTPPLSPFSPPLSPFSDQSEAGSARSYGEDSLPEEAVKVTRSIMIIKPP GYQGSSAPASPAGSTPPLSPFSPPLSPFS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Zhang et al., 2019 |