Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G56220_circ_g.2 |
ID in PlantcircBase | ath_circ_007718 |
Alias | At_ciR5426, AT1G56220_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 21043704-21043889 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full, CIRI2 |
Parent gene | AT1G56220 |
Parent gene annotation |
Dormancy/auxin associated family protein |
Parent gene strand | + |
Alternative splicing | AT1G56220_circ_g.1 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G56220.4:1 AT1G56220.5:1 AT1G56220.1:1 AT1G56220.2:1 AT1G56220.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.538056374 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21043784-21043886(+) |
Potential amino acid sequence |
MIIKPPGYQGSSAPASPAGSTPPLSPFSPPLSPFSDQSEAGSARSYGEDSLPEEAVKVTRSIMI IKPPGYQGSSAPASPAGSTPPLSPFSPPLSPFSDQSEAGSARSYGEDSLPEEAVKVTRSIMIIK PPGYQGSSAPASPAGSTPPLSPFSPPLSPFSDQSEAGSARSYGEDSLPEEAVKVTRSIMIIKPP GYQGSSAPASPAGSTPPLSPFSPPLSPFS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Zhang et al., 2019 |