Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Bra030676_circ_g.1 |
| ID in PlantcircBase | bra_circ_000414 |
| Alias | A08:20078021|20078200 |
| Organism | Brassica rapa |
| Position | chrA08: 20078021-20078200 JBrowse» |
| Reference genome | Brassica rapa v2 |
| Type | ie-circRNA |
| Identification method | Find_circ |
| Parent gene | Bra030676 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Bra0A30A676:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_000695 ath_circ_000694 |
| PMCS | 0.804169444 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20078157-20078023(-) |
| Potential amino acid sequence |
MGKAGGGRALSAKETELGEPFVYKHLGSMATIGRYKALVDLRESKVAEREGKYLANLLNVMGKA GGGRALSAKETELGEPFVYKHLGSMATIGRYKALVDLRESKVAEREGKYLANLLNVMGKAGGGR ALSAKETELGEPFVYKHLGSMATIGRYKALVDLRESKVAEREGKYLANLLNVMGKAGGGRALSA KETELGEPFVYKHLGSMATIGRYKALVDLRESK |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Wang et al., 2019 |