Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G02120_circ_g.21 |
| ID in PlantcircBase | ath_circ_029332 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 943411-943627 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT4G02120 |
| Parent gene annotation |
CTP synthase family protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G02120.5:2 AT4G02120.4:1 AT4G02120.2:2 AT4G02120.1:2 AT4G02120.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.275181178 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
943426-943624(+) |
| Potential amino acid sequence |
MGSTMRLGSRRTHLHNRDSLTSKLYGQVSYVDERHRHRYEGSRTHMGSTMRLGSRRTHLHNRDS LTSKLYGQVSYVDERHRHRYEGSRTHMGSTMRLGSRRTHLHNRDSLTSKLYGQVSYVDERHRHR YEGSRTHMGSTMRLGSRRTHLHNRDSLTSKLYGQVSYVDERHRHRYE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |