Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G38760_circ_g.20 |
| ID in PlantcircBase | ath_circ_035486 |
| Alias | Ath_circ_FC3060 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 18095787-18095960 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI-full, PcircRNA_finder |
| Parent gene | AT4G38760 |
| Parent gene annotation |
Protein of unknown function (DUF3414) |
| Parent gene strand | - |
| Alternative splicing | AT4G38760_circ_g.19 |
| Support reads | 3 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G38760.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.422892237 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18095913-18095789(-) |
| Potential amino acid sequence |
MFKPPSEKSKEALNSDLVKIKEHQLVIKPQLKDKALRISSHLAKKLEENHAWFVGTLSMFKPPS EKSKEALNSDLVKIKEHQLVIKPQLKDKALRISSHLAKKLEENHAWFVGTLSMFKPPSEKSKEA LNSDLVKIKEHQLVIKPQLKDKALRISSHLAKKLEENHAWFVGTLSMFKPPSEKSKEALNSDLV KIKEHQLVIKPQLKDKALRISSHL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |