Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0408600_circ_g.4 |
| ID in PlantcircBase | osa_circ_023748 |
| Alias | Os_ciR9331 |
| Organism | Oryza sativa |
| Position | chr4: 20222115-20222225 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0408600 |
| Parent gene annotation |
Protein of unknown function DUF662 family protein. (Os04t0408600 -01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0408600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186186186 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20222215-20222117(-) |
| Potential amino acid sequence |
MADPTRKEVEVIRKRIDVVNRQLKPLGKTCVKKELEGMADPTRKEVEVIRKRIDVVNRQLKPLG KTCVKKELEGMADPTRKEVEVIRKRIDVVNRQLKPLGKTCVKKELEGMADPTRKEVEVIRKRID VVNRQLKPLGKTCVKK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |