Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G088700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000600 |
| Alias | Chr06:32442977|32443158 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 32442977-32443158 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G088700 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G088700.1:1 Gorai.006G088700.2:1 Gorai.006G088700.5:1 Gorai.006G088700.4:1 Gorai.006G088700.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.542123397 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32443139-32443073(+) 32443101-32442996(+) 32443004-32443056(-) |
| Potential amino acid sequence |
MQALLEKSTKEPCLNISNGRSRRLMPYARQHSATVISRN*(+) MTLGNLAVRLLRRCRLCLKSRRKSRA*(+) MFKHGSFVDFSSRACIFLRAEPQGCLASSLNDAASDSSFLRSQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |