Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0243800_circ_g.2 |
ID in PlantcircBase | osa_circ_018823 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 7604190-7604825 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os03g0243800 |
Parent gene annotation |
Nicotinamide N-methyltransferase, putative domain containing pro tein. (Os03t0243800-00) |
Parent gene strand | + |
Alternative splicing | Os03g0243800_circ_g.1 Os03g0243800_circ_g.3 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0243800-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_010066 |
PMCS | 0.135483268 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7604280-7604773(-) |
Potential amino acid sequence |
MTLNQVKATRCLSGNFVSIIFILLIVRSFLHKSSSVNIVSVRSYNVI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |