Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G09760_circ_g.1 |
| ID in PlantcircBase | ath_circ_001739 |
| Alias | At_ciR3327 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 3159578-3160081 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT1G09760 |
| Parent gene annotation |
U2 small nuclear ribonucleoprotein A' |
| Parent gene strand | - |
| Alternative splicing | AT1G09760_circ_g.2 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G09760.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141791617 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3159584-3159580(-) |
| Potential amino acid sequence |
MEERAEAASLFSSKEAEEEVKKVSREEVKKVSETAENPETPKVVAPTAEQILAIKAAIINSQTI EEIARLEQALKFGQVPAGLIIPDPATNDSAPMEERAEAASLFSSKEAEEEVKKVSREEVKKVSE TAENPETPKVVAPTAEQILAIKAAIINSQTIEEIARLEQALKFGQVPAGLIIPDPATNDSAPME ERAEAASLFSSKEAEEEVKKVSREEVKKVSETAENPETPKVVAPTAEQILAIKAAIINSQTIEE IARLEQALKFGQVPAGLIIPDPATNDSAPME(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |