Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G092300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000603 |
| Alias | Chr06:32928376|32928889 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 32928376-32928889 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G092300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.006G092300_circ_g.2 |
| Support reads | 10 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G092300.6:3 Gorai.006G092300.1:3 Gorai.006G092300.4:3 Gorai.006G092300.5:3 Gorai.006G092300.3:3 Gorai.006G092300.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000134* gar_circ_000237* |
| PMCS | 0.171206145 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32928420-32928391(+) 32928604-32928839(-) |
| Potential amino acid sequence |
MTLSSYANSSVEEVASTGSGIRFFQLYVHKDRNLVAQLVRRAERAGFKAIALTADTPRLGRREA DIKNRRMCNS*(+) MPDPVEATSSTLEFAYDDSVMIVPASEAALAVAHSPIFNISFPAAESWSICR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |