Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0108400_circ_g.1 |
| ID in PlantcircBase | osa_circ_038391 |
| Alias | Os_ciR12020 |
| Organism | Oryza sativa |
| Position | chr9: 804745-805078 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0108400 |
| Parent gene annotation |
Similar to predicted protein. (Os09t0108400-01);Conserved hypoth etical protein. (Os09t0108400-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0108400-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018854 |
| PMCS | 0.335266467 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
804749-804797(+) 804879-804815(-) |
| Potential amino acid sequence |
MEISEQDLKAQLDNAQNEQYASQNKASAAASDNTGNALMEAESLINLKSNDLKEKNEELKLLES SVRVLEMEWSVVEGESLKNPTPGNGNFRAGFEGTAGQCSE*(+) MIQLPSKHFQYCQKQQLMLYFEKHIAHSEHCPAVPSNPALKFPFPGVGFFKDSPSTTDHSISST RTLLSNNFSSSFFSFKSLDLRLINDSASIKAFPVLSEAAADALF*(-) |
| Sponge-miRNAs | osa-miR5076 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |