Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0108400_circ_g.1 |
ID in PlantcircBase | osa_circ_038391 |
Alias | Os_ciR12020 |
Organism | Oryza sativa |
Position | chr9: 804745-805078 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os09g0108400 |
Parent gene annotation |
Similar to predicted protein. (Os09t0108400-01);Conserved hypoth etical protein. (Os09t0108400-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0108400-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018854 |
PMCS | 0.335266467 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
804749-804797(+) 804879-804815(-) |
Potential amino acid sequence |
MEISEQDLKAQLDNAQNEQYASQNKASAAASDNTGNALMEAESLINLKSNDLKEKNEELKLLES SVRVLEMEWSVVEGESLKNPTPGNGNFRAGFEGTAGQCSE*(+) MIQLPSKHFQYCQKQQLMLYFEKHIAHSEHCPAVPSNPALKFPFPGVGFFKDSPSTTDHSISST RTLLSNNFSSSFFSFKSLDLRLINDSASIKAFPVLSEAAADALF*(-) |
Sponge-miRNAs | osa-miR5076 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |