Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0112900_circ_g.2 |
ID in PlantcircBase | osa_circ_012706 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 686936-695313 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0112900 |
Parent gene annotation |
Similar to Viroid RNA-binding protein (Fragment). (Os02t0112900- 00) |
Parent gene strand | - |
Alternative splicing | Os02g0112900_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0112900-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.0900748 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
687006-686938(-) |
Potential amino acid sequence |
MFTAREMGKVFFTNSGSEANDSQGCYVYDVNGTKYLDALAGLLSTALGGSEPRLVKAATEQLNK LPFYHSFWNHTTRPSLDLAKELISMFTAREMGKVFFTNSGSEANDSQGCYVYDVNGTKYLDALA GLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKELISMFTAREMGKVFFTNSG SEANDSQGCYVYDVNGTKYLDALAGLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSL DLAKELISMFTAREMGKVFFTNSGSEANDSQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |