Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0223833_circ_g.5 |
ID in PlantcircBase | osa_circ_036388 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 7507179-7509795 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0223833 |
Parent gene annotation |
Similar to H0702G05.10 protein. (Os08t0223833-00) |
Parent gene strand | + |
Alternative splicing | Os08g0223833_circ_g.6 Os08g0223833_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0223833-00:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.10525521 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7507264-7507195(+) 7507292-7509700(-) |
Potential amino acid sequence |
MGRRHYMLAFEGSTEGMYRVIRPAVGEALREMPLVELKSKYRKVSSIDKIGNGWQEEYDASSKQ VRQIHKRIRVARLETNDNERIVGLMIPNSAVESVLEVGKCNT*(+) MLACNAFDPSILFWIHKIQHLNNQLHLSAFLQVLHLPTSNTDSTAEFGIISPTIRSLSFVSKRA TRILL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |