Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G51430_circ_g.3 |
| ID in PlantcircBase | ath_circ_043633 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 20890105-20890403 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT5G51430 |
| Parent gene annotation |
Conserved oligomeric Golgi complex component-related / COG compl ex component-like protein |
| Parent gene strand | - |
| Alternative splicing | AT5G51430_circ_g.4 |
| Support reads | 3 |
| Tissues | seedlings |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G51430.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.262955583 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20890341-20890107(-) |
| Potential amino acid sequence |
MEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEAEGSSADCIAALARV DNVKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEAEGSSADCI AALARVDNVKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEAEG SSADCIAALARVDNVKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSA VGE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Pan et al., 2017 |