Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0258400_circ_g.5 |
| ID in PlantcircBase | osa_circ_033348 |
| Alias | Os_ciR2460 |
| Organism | Oryza sativa |
| Position | chr7: 8968062-8969658 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0258400 |
| Parent gene annotation |
OsNramp1 (Integral membrane protein). (Os07t0258400-01);Similar to Metal transporter. (Os07t0258400-02);Integral membrane protei n, Metal ion transport (Os07t0258400-03) |
| Parent gene strand | + |
| Alternative splicing | Os07g0258400_circ_g.1 Os07g0258400_circ_g.2 Os07g0258400_circ_g.3 Os07g0258400_circ_g.4 Os07g0258400_circ_g.6 Os07g0258400_circ_g.7 Os07g0258400_circ_g.8 Os07g0258400_circ_g.9 Os07g0258400_circ_g.10 Os07g0258400_circ_g.11 Os07g0258400_circ_g.12 |
| Support reads | 4/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0258400-01:6 Os07t0258400-03:6 Os07t0258400-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.333258595 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8968396-8968064(+) 8968428-8969650(-) |
| Potential amino acid sequence |
MAGCFFVEMSIVKPPVNEVLQGLFIPRLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPA SAKGMKDVCRFFLFESGIALFVALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLR NVLGKSSATVYGVALLASGQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSI IGGSSGAGRLIVIASL*(+) MLISTKKHPAMTNTNSATTTSSFLTPYLCSPRRRSVLEPAMRTPVHTGMWNKRLKANPVPITMQ *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |