Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0330300_circ_g.1 |
| ID in PlantcircBase | osa_circ_019631 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 12155085-12156087 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0330300 |
| Parent gene annotation |
Similar to cDNA clone:001-032-H02, full insert sequence (Fragmen t). (Os03t0330300-01);Similar to cDNA clone:001-032-H02, full in sert sequence (Fragment). (Os03t0330300-02);Viral attachment pro tein, fibre shaft repeat containing protein. (Os03t0330300-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0330300_circ_g.2 Os03g0330300_circ_g.3 Os03g0330300_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0330300-03:4 Os03t0330300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216677335 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12156074-12155982(+) 12155863-12155087(-) |
| Potential amino acid sequence |
MVFRNFVASDEFGPTFPCCSTPMVPKTPPDKAPPIGFRCSLE*(+) MGGALSGGVFGTIGVEQQGNVGPNSSEATKFLNTINSPDASKSANGILHEISQLEETRKFHQSL YSKEQRNPMGGALSGGVFGTIGVEQQGNVGPNSSEATKFLNTINSPDASKSANGILHEISQLEE TRKFHQSLYSKEQRNPMGGALSGGVFGTIGVEQQGNVGPNSSEATKFLNTINSPDASKSANGIL HEISQLEETRKFHQSLYSKEQRNPMGGALSGGVFGTIGVEQQGNVGPNSSEAT(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |