Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G53490_circ_g.1 |
ID in PlantcircBase | ath_circ_007166 |
Alias | AT1G53490_C1, AT1G53490_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 19965298-19965635 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G53490 |
Parent gene annotation |
E3 ubiquitin-protein ligase CCNB1IP1 homolog |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G53490.2:3 AT1G53490.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.25071957 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19965460-19965632(+) |
Potential amino acid sequence |
MKPVDINPNEEWINMAMAGISPQIRTEDASKILSNDGACPICDQVLSKSLMKPVDINPNEEWIN MAMAGISPQIRTEDASKILSNDGACPICDQVLSKSLMKPVDINPNEEWINMAMAGISPQIRTED ASKILSNDGACPICDQVLSKSLMKPVDINPNEEWINMAMAGISPQI |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |