Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0175400_circ_g.1 |
| ID in PlantcircBase | osa_circ_013415 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 4121859-4122287 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0175400 |
| Parent gene annotation |
Similar to Vacuolar H(+)-ATPase subunit A (Fragment). (Os02t0175 400-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0175400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.197671484 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4122284-4122026(+) 4122065-4121861(-) |
| Potential amino acid sequence |
MLPCRLSWDLVFLGTFLMGSSAL*(+) MYTSPDLIAIVFRGRWIPSKMFPRIPGPNSTDRGAYRSPPVIISPTPSFSGLKCHKASLSRAGT ETPRGMYTSPDLIAIVFRGRWIPSKMFPRIPGPNSTDRGAYRSPPVIISPTPSFSGLKCHKASL SRAGTETPRGMYTSPDLIAIVFRGRWIPSKMFPRIPGPNSTDRGAYRSPPVIISPTPSFSGLKC HKASLSRAGTETPRGMYTSPDLIAIVFRGRWIPSKMFPRIPGPNSTDR(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |