Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0527100_circ_g.2 |
| ID in PlantcircBase | osa_circ_031064 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 19550547-19550783 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0527100 |
| Parent gene annotation |
Similar to Cyclic nucleotide-gated channel A (Fragment). (Os06t0 527100-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0526400_circ_ag.1 Os06g0526400_circ_ag.2 Os06g0526600_circ_g.1 Os06g0526600_circ_g.2 Os06g0526600_circ_g.3 Os06g0526700_circ_g.1 Os06g0526700_circ_ag.1 Os06g0527100_circ_g.1 Os06g0527100_circ_g.2 Os06g0527100_circ_ag.1 Os06g0527100_circ_g.2 Os06g0527100_circ_ag.3 Os06g0527100_circ_ag.4 Os06g0527100_circ_g.5 Os06g0527100_circ_g.6 Os06g0527100_circ_ag.7 Os06g0527100_circ_igg.1 Os06g0527100_circ_igg.3 Os06g0527100_circ_igg.4 Os06g0527300_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0527100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.695655023 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19550584-19550780(+) 19550624-19550778(-) |
| Potential amino acid sequence |
MRVKSRDTDQWMSYRLLPENLKERIRRHEKYRWHQTSGVDEELLLMNLPKDLRRAIKRHLCLSL LMRTYLQSAHLREEEMRVKSRDTDQWMSYRLLPENLKERIRRHEKYRWHQTSGVDEELLLMNLP KDLRRAIKRHLCLSLLMRTYLQSAHLREEEMRVKSRDTDQWMSYRLLPENLKERIRRHEKYRWH QTSGVDEELLLMNLPKDLRRAIKRHLCLSLLMRTYLQSAHLREEEMRVKSRDTDQWMSYRLLPE NLKERIRRHEKYRWHQTSGVDEELLLMNLPKDLRRAIKRHLCLSLLMR(+) MTSIDLYHGFSLSFLLLSDGLTANRSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |