Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0485400_circ_g.1 |
| ID in PlantcircBase | osa_circ_037414 |
| Alias | Os_ciR1495 |
| Organism | Oryza sativa |
| Position | chr8: 23990304-23991140 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0485400 |
| Parent gene annotation |
Similar to Oxidoreductase. (Os08t0485400-01);Similar to 2-nitrop ropane dioxygenase-like protein. (Os08t0485400-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 9/4 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0485400-01:3 Os08t0485400-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007816* osi_circ_018005 |
| PMCS | 0.40457264 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23990389-23990972(-) 23990361-23991106(-) |
| Potential amino acid sequence |
MPPCFTALNNDPIYTSFLSFRCLLKATNHTMDDSVAYDRLIFLCFLFWEILPLIIEGCFQDTLG STRPSSTPKHIGIARAINLD*(-) MIPSTPASLAFAASSKLPTTPWMIVWPMIG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |