Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0485400_circ_g.1 |
ID in PlantcircBase | osa_circ_037414 |
Alias | Os_ciR1495 |
Organism | Oryza sativa |
Position | chr8: 23990304-23991140 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os08g0485400 |
Parent gene annotation |
Similar to Oxidoreductase. (Os08t0485400-01);Similar to 2-nitrop ropane dioxygenase-like protein. (Os08t0485400-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 9/4 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0485400-01:3 Os08t0485400-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007816* osi_circ_018005 |
PMCS | 0.40457264 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23990389-23990972(-) 23990361-23991106(-) |
Potential amino acid sequence |
MPPCFTALNNDPIYTSFLSFRCLLKATNHTMDDSVAYDRLIFLCFLFWEILPLIIEGCFQDTLG STRPSSTPKHIGIARAINLD*(-) MIPSTPASLAFAASSKLPTTPWMIVWPMIG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |