Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G19440_circ_g.4 |
ID in PlantcircBase | ath_circ_039225 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 6557125-6557316 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | AT5G19440 |
Parent gene annotation |
At5g19440 |
Parent gene strand | + |
Alternative splicing | AT5G19440_circ_g.3 AT5G19440_circ_g.5 |
Support reads | 10 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G19440.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.33653353 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6557221-6557313(+) |
Potential amino acid sequence |
MAAVGYNGKPRTPDVTVDETWFSDPELCEASKAELIDPAVKGTLNVLNSCAKASSVKRVVVTSS MAAVGYNGKPRTPDVTVDETWFSDPELCEASKAELIDPAVKGTLNVLNSCAKASSVKRVVVTSS MAAVGYNGKPRTPDVTVDETWFSDPELCEASKAELIDPAVKGTLNVLNSCAKASSVKRVVVTSS MAAVGYNGKPRTPDVTVDETWFSDPELCEASK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |