Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0320100_circ_g.4 |
| ID in PlantcircBase | osa_circ_023399 |
| Alias | Os_ciR9269 |
| Organism | Oryza sativa |
| Position | chr4: 14712990-14713098 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0320100 |
| Parent gene annotation |
Coenzyme F420 hydrogenase/dehydrogenase beta subunit, N-terminal domain containing protein. (Os04t0320100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0320100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.222475 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14713033-14713036(+) 14713004-14713070(-) 14713012-14713070(-) 14713035-14713070(-) |
| Potential amino acid sequence |
MDEMYFGVYEQLLYARKMKPVEGFGAIGPWEGQEARHG*(+) MAPNPSTGFIFLAYRSCSYTPKYISSMSCFLPLPWTNGSKSFNRFHLPGI*(-) MDQWLQILQQVSSSWHIGVAHTLRSTSHPCLASCPSHGPMAPNPSTGFIFLAYRSCSYTPKYIS SMSCFLPLPWTNGSKSFNRFHLPGI*(-) MSCFLPLPWTNGSKSFNRFHLPGI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |