Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0296200_circ_g.2 |
| ID in PlantcircBase | osa_circ_033423 |
| Alias | Os_ciR746 |
| Organism | Oryza sativa |
| Position | chr7: 11593141-11593419 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circseq_cup, find_circ |
| Parent gene | Os07g0296200 |
| Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os07t0296200-01);Similar to predicted protein. (Os07t0296200-02 ) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 35/5/7 |
| Tissues | root/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0296200-01:2 Os07t0296200-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.719581609 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11593257-11593375(-) 11593268-11593398(-) |
| Potential amino acid sequence |
MYDEFGNLKKKFRAKTQQTENAPTLPGSGRAGWEVEQREVAGVVGIKNLMKKN*(-) MTERCMMNLATSKRNFVLKHNKLKMHQLFLGLDVLDGRSSNVRWPGWWV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |