Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0407500_circ_g.1 |
ID in PlantcircBase | osa_circ_011286 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 12324259-12326153 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0407500 |
Parent gene annotation |
Tensin phosphatase, C2 domain domain containing protein. (Os12t0 407500-01);Similar to PTEN-like protein. (Os12t0407500-02) |
Parent gene strand | - |
Alternative splicing | Os12g0407200_circ_ag.1 Os12g0407500_circ_igg.1 Os12g0407500_circ_g.2 Os12g0407500_circ_g.3 Os12g0407500_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0407500-01:6 Os12t0407500-02:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.419252206 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12326148-12324317(+) 12326038-12324261(+) 12326008-12326071(-) |
Potential amino acid sequence |
MQPVEIPLSIMKLNLEVTSYLC*(+) MNNHYIFYIFLQPRVSTMAERYDKLYRRAIVIIKREACNQ*(+) MISSLLLYLKFFPTAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFNGENQPPRRCML RGFRLHRCPYWIRPSITVSNHNGVLFTTKKHPRTKELMPEDFWFSAPKKGIMVFALPGEPGLTE VAGDFKIQFHDRQGDFYWLHASLLMITIALRYNLSYRSAIVLTLG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |