Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0407500_circ_g.1 |
| ID in PlantcircBase | osa_circ_011286 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 12324259-12326153 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0407500 |
| Parent gene annotation |
Tensin phosphatase, C2 domain domain containing protein. (Os12t0 407500-01);Similar to PTEN-like protein. (Os12t0407500-02) |
| Parent gene strand | - |
| Alternative splicing | Os12g0407200_circ_ag.1 Os12g0407500_circ_igg.1 Os12g0407500_circ_g.2 Os12g0407500_circ_g.3 Os12g0407500_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0407500-01:6 Os12t0407500-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.419252206 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12326148-12324317(+) 12326038-12324261(+) 12326008-12326071(-) |
| Potential amino acid sequence |
MQPVEIPLSIMKLNLEVTSYLC*(+) MNNHYIFYIFLQPRVSTMAERYDKLYRRAIVIIKREACNQ*(+) MISSLLLYLKFFPTAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFNGENQPPRRCML RGFRLHRCPYWIRPSITVSNHNGVLFTTKKHPRTKELMPEDFWFSAPKKGIMVFALPGEPGLTE VAGDFKIQFHDRQGDFYWLHASLLMITIALRYNLSYRSAIVLTLG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |