Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G61150_circ_g.1 |
| ID in PlantcircBase | ath_circ_028548 |
| Alias | AT3G61150_C1, AT3G61150_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 22631018-22631226 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT3G61150 |
| Parent gene annotation |
HDG1 |
| Parent gene strand | + |
| Alternative splicing | AT3G61150_circ_g.2 AT3G61150_circ_g.3 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G61150.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.478292327 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22631034-22631033(+) |
| Potential amino acid sequence |
MSRNGEIMESNVSRKSSRGEDVESRSESDNAEAVSGDDLDTSDRPLKKKKRYHRHTPKQIQDLE SKQMEK* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |