Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G09820_circ_g.1 |
| ID in PlantcircBase | ath_circ_020712 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3012320-3012373 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | u-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G09820 |
| Parent gene annotation |
Adenosine kinase 1 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G09820.1:1 AT3G09820.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.162033333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3012374-3012322(-) 3012366-3012322(-) |
| Potential amino acid sequence |
MGKCLSSARIALFNLMSYMGKCLSSARIALFNLMSYMGKCLSSARIALFNLMSYMGKCLSSARI ALFNLMSY(-) MFVLCENRIVQFDVVYGQMFVLCENRIVQFDVVYGQMFVLCENRIVQFDVVYGQMFVLCENRIV QFDVV(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |