Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0571900_circ_g.1 |
| ID in PlantcircBase | osa_circ_043701 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 23545880-23546184 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os12g0571900 |
| Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os12t 0571900-01) |
| Parent gene strand | + |
| Alternative splicing | Os12g0571900_circ_g.2 Os12g0571900_circ_g.3 Os12g0571900_circ_g.4 Os12g0571900_circ_g.5 Os12g0571900_circ_g.6 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0571900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.208523989 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23546109-23546121(+) 23546095-23546121(+) |
| Potential amino acid sequence |
MSAKDDEATKQIFSRCLLSCLQINLCCSQSARPLPSTRSCCQLSPLPRSTGSSMSKLTCPRRMM RPPSRYSADACSVAFRLISAAPNRRGRSHLREAAVNFPHCREVLEAVCRSLHVREG*(+) MSKLTCPRRMMRPPSRYSADACSVAFRLISAAPNRRGRSHLREAAVNFPHCREVLEAVCRSLHV REG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |