Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0571900_circ_g.1 |
ID in PlantcircBase | osa_circ_043701 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 23545880-23546184 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | Os12g0571900 |
Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os12t 0571900-01) |
Parent gene strand | + |
Alternative splicing | Os12g0571900_circ_g.2 Os12g0571900_circ_g.3 Os12g0571900_circ_g.4 Os12g0571900_circ_g.5 Os12g0571900_circ_g.6 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0571900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.208523989 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23546109-23546121(+) 23546095-23546121(+) |
Potential amino acid sequence |
MSAKDDEATKQIFSRCLLSCLQINLCCSQSARPLPSTRSCCQLSPLPRSTGSSMSKLTCPRRMM RPPSRYSADACSVAFRLISAAPNRRGRSHLREAAVNFPHCREVLEAVCRSLHVREG*(+) MSKLTCPRRMMRPPSRYSADACSVAFRLISAAPNRRGRSHLREAAVNFPHCREVLEAVCRSLHV REG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |