Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0955700_circ_g.4 |
| ID in PlantcircBase | osa_circ_005868 |
| Alias | Os_ciR6471 |
| Organism | Oryza sativa |
| Position | chr1: 42091072-42091195 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0955700 |
| Parent gene annotation |
CRT-like transporter, Glutathione homeostasis, Arsenic tolerance (Os01t0955700-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0955700_circ_g.1 Os01g0955700_circ_g.2 Os01g0955700_circ_g.3 Os01g0955700_circ_g.5 Os01g0955700_circ_g.6 |
| Support reads | 2/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0955700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.24395457 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42091082-42091171(+) 42091114-42091171(+) |
| Potential amino acid sequence |
MCLLLPFLSKLWGVPFHQLPTYIRDGTACFLNMGSLSSGSFHVSLVAILVKVMGSAIPSTTNIH QRWHRLLSEHGITIFWLFSCVSCCHSCQSYGECHSINYQHTSEMAPPAF*(+) MGSAIPSTTNIHQRWHRLLSEHGITIFWLFSCVSCCHSCQSYGECHSINYQHTSEMAPPAF*(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |