Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G030900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000694 |
| Alias | Chr07:2135769|2137087 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 2135769-2137087 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G030900 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.007G030900.2:3 Gorai.007G030900.1:3 Gorai.007G030900.4:3 Gorai.007G030900.3:3 Gorai.007G030900.6:3 Gorai.007G030900.5:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000394* |
| PMCS | 0.991554119 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2135827-2135786(+) 2135786-2136987(-) |
| Potential amino acid sequence |
MQPIPPPLLDRMEVIELPGYTAEEKLRIAMQHLIPRVLDQHGLSSAFLQIPEDMVKLVIQRYTR EAGVRNLERNLAALARAAAVRVAEREQAVSVSKDVHKITSPLLDNRLAEGAEMEMEVIPMVVNN HEISNAFRIASPLVVDEAMLEKILGPPRFDDQEAADRVATPGVSVGLVWTAFGGEVQFVEATSV VGNGELRLTGQLGDVIKESAQIALTWLFECSI*(+) MEHSNSHVSAICADSLITSPSCPVRRNSPFPTTDVASTN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |