Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G22480_circ_g.3 |
ID in PlantcircBase | ath_circ_014378 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 9546604-9546888 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G22480 |
Parent gene annotation |
ATP-dependent 6-phosphofructokinase 5, chloroplastic |
Parent gene strand | + |
Alternative splicing | AT2G22480_circ_g.1 AT2G22480_circ_g.2 AT2G22480_circ_g.4 |
Support reads | 5 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G22480.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215150234 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9546694-9546885(+) |
Potential amino acid sequence |
MPLSRKVVQNIHLSGGSLLGVSRGGPSVSEIVDSMEIVITLEIYGVKNIVGIPFGYRGFSDKDL TEMPLSRKVVQNIHLSGGSLLGVSRGGPSVSEIVDSMEIVITLEIYGVKNIVGIPFGYRGFSDK DLTEMPLSRKVVQNIHLSGGSLLGVSRGGPSVSEIVDSMEIVITLEIYGVKNIVGIPFGYRGFS DKDLTEMPLSRKVVQNIHLSGGSLLGVSRGGPSVSEIVDSME(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |