Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0128450_circ_g.3 |
| ID in PlantcircBase | osa_circ_029500 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 1508687-1509305 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os06g0128400 |
| Parent gene annotation |
WD40 repeat-like domain containing protein. (Os06t0128400-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0128450_circ_g.2 |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0128450-00:3 Os06t0128400-01:3 Os06t0128450-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.214725646 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1508904-1508692(+) 1509243-1509296(-) |
| Potential amino acid sequence |
MTSIEPDGGTINDVCVFRNSGLMLLALDNSQIPAHFIPALGPAPKWCSHLDNLTEEMEEKTENI VYEDFKFLTKDEMDRYDLSKYIDQGLVRAHMHGYVMKLQLYKKVW*(+) MYLERSYRSISSFVKNLKSSYTIFSVFSSISSVRLSRCEHHFGAGPNAGIKWAGIWLLSKANNI KPLFRKTQTSLIVPPSGSMLVMLFPVLGSQTLTICLSAVISLGSVELSVWCHLILNIGLPYLLI *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |