Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0100100_circ_g.1 |
ID in PlantcircBase | osa_circ_010255 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 3002-3836 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0100100 |
Parent gene annotation |
Similar to ALY protein. (Os12t0100100-01);Similar to ALY protein . (Os12t0100100-02);Similar to ALY protein. (Os12t0100100-03) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0100100-03:3 Os12t0100100-02:3 Os12t0100100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.150415768 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3740-3739(+) |
Potential amino acid sequence |
MKLELIGINIEPPPPAIFGFAAPAGYFDFPPKRRRPRPTSTRRPRPTSRPAPSSTSPTSTTPSP TRTSRNSSLRLAMSSVTLLTMTGVEDPRELQRLYFPENLTPWLLLRGTTMCSWMANL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |