Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0290100_circ_g.1 |
| ID in PlantcircBase | osa_circ_036603 |
| Alias | Os_ciR11346 |
| Organism | Oryza sativa |
| Position | chr8: 11561483-11561952 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0290100 |
| Parent gene annotation |
Pentatricopeptide repeat containing protein. (Os08t0290100-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0290100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.217378457 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11561502-11561938(-) |
| Potential amino acid sequence |
MVQILQVNQTNEELCSVLSLYSLQNIALVSRCKQQHILSACGSVVLQHSKILTFCGFTYLGLLT GNDVTSATDKISKDEDADLLECFSFAMNGANLAGKPDE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |